PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa19g057940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ZF-HD
Protein Properties Length: 206aa    MW: 22428.1 Da    PI: 8.9921
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa19g057940.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.61.1e-3177131358
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                     k+rY+eC+kNhAas Ggh+vDGCgEfm+s geegtaa+l CaAC+CHR+FHR+e +
  Csa19g057940.1  77 KARYRECQKNHAASSGGHVVDGCGEFMSS-GEEGTAASLLCAACDCHRSFHRKEID 131
                     689*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-3965140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.3E-2978130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.7E-3079130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.59280129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MEVREKKDEK IEMVRSKPSV LDHHRLPPYA YPQTADKDKP TTKRNGSDPD PDLDTNPISI  60
APAPRSYARP QTTSPGKARY RECQKNHAAS SGGHVVDGCG EFMSSGEEGT AASLLCAACD  120
CHRSFHRKEI DGLFVVNFNS FGHSQRPLVG RHVSPIMMSF GGGGGGGGPA ESSTEDLNKF  180
HQSFSGNGVD QFHQFQPKKR KKTMK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1197201KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064390.0AC006439.4 Arabidopsis thaliana chromosome 2 clone T30D6 map mi39, complete sequence.
GenBankAY0882550.0AY088255.1 Arabidopsis thaliana clone 4845 mRNA, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010489538.11e-150PREDICTED: zinc-finger homeodomain protein 6 isoform X1
RefseqXP_010489539.11e-150PREDICTED: zinc-finger homeodomain protein 6 isoform X2
SwissprotQ9ZPW71e-123ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLR0GAP21e-129R0GAP2_9BRAS; Uncharacterized protein
STRINGscaffold_304185.11e-127(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-120homeobox protein 24